Structure of PDB 8br8 Chain LH

Receptor sequence

>8br8LH (length=213) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

ERATEKEKRAALVKDHAVKSAQVYARYYIDLVESEKKARENALKNNQLYV
PDEPKVYLVVRIRGIVGVAPKVRTILSLLRLRQINNAVFMRCNKATLNAL
RIVDHYVTYGEPTVETIRNLIYKRGFAKVNGQRIPIVDNNLIDEQLSKHN
ILCAEDLVHEIFTCGSSFKEANNFLWPFQLNSAALKDKRNNFAEGGDFGY
RGKYINEFVARMI

3D structure

PDB

8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LH	R123 H127 R211 N212 N213 E216 F220	R101 H105 R189 N190 N191 E194 F198
BS02	rna	LH	R85 G86 I87 V88 G89 P92 K93 R95 T96 I97 L100 R102 Q105 I106 R113 N115 K116 A117 N120 N152 Q154 R155 E166 Q167 K191 N195 Q201 L202 N203 S204 A206 K210 R211 R233	R63 G64 I65 V66 G67 P70 K71 R73 T74 I75 L78 R80 Q83 I84 R91 N93 K94 A95 N98 N130 Q132 R133 E144 Q145 K169 N173 Q179 L180 N181 S182 A184 K188 R189 R211

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum	8br8
PubMed	36912103
UniProt	A8BRY6

[Back to BioLiP]