Structure of PDB 7qca Chain LGG

Receptor sequence

>7qcaLGG (length=104) Species: 1358809 (Spraguea lophii 42_110) [Search protein sequence]

VERQVVRRGSTFNTRSNKRKKVRTPGNRLVFQDVKKKGKGPKCGQCGIKL
AGVKEARPAAFSRMRKSCRKVNRILGGVQCAKCVQEKVLDAFLNAEEKRM
KELE

3D structure

PDB

7qca Spraguea lophii ribosome

Chain

LGG

Resolution

2.79 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LGG	V2 R4 Q5 V6 R8 R9 T12 F13 T15 R16 S17 K22 R24 T25 P26 R29 Q33 K36 K37 K38 K40 P42 K43 G45 G53 V54 K55 E56 R58 A60 S63 R66 K67 R70 V72 N73 R74 I75 G77 V79	V1 R3 Q4 V5 R7 R8 T11 F12 T14 R15 S16 K21 R23 T24 P25 R28 Q32 K35 K36 K37 K39 P41 K42 G44 G52 V53 K54 E55 R57 A59 S62 R65 K66 R69 V71 N72 R73 I74 G76 V78
BS02	ZN	LGG	C44 C84	C43 C83

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links