Structure of PDB 8pv8 Chain LG

Receptor sequence

>8pv8LG (length=235) Species: 759272 (Thermochaetoides thermophila DSM 1495)

PKNPLLEKRPRNFGIGQDIQPKRNLSRMVKWPEYIRLQRQKKILRMRLKV
PPAIAQFQYTLDKNLAAQAFKLLNKYRPETKQEKKERLLREATAIKEGKK
KEDVSKKPYTVKYGLNHVVGLIENKKASLVLIANDVDPIELVVFLPALCR
KMGIPYAIIKGKARLGTLVHKKTAAVVAITEVRSEDKNELAKLISAVKEG
YLEKVEDTRKRWGGGIMGFKAQKREEKRKKSLETA

3D structure

• PDB: 8pv8 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Chain: LG
• Resolution: 2.91 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LG	E31 K32 R33 R35 F37 G38 I39 G40 Q41 Q44 P45 R47 L49 S50 R51 M52 K54 E57 Y58 R63 L68 R71 L72 E103 K108 K109 R111 S129 K130 K131 P132 K136 Y137 G138 L139 N140 H141 G144 L145 N148 V160 D161 L165 K186 A187 K195 K196 T197 A198 A199 G242 F243 K244 A245 R248	E7 K8 R9 R11 F13 G14 I15 G16 Q17 Q20 P21 R23 L25 S26 R27 M28 K30 E33 Y34 R39 L44 R47 L48 E79 K84 K85 R87 S105 K106 K107 P108 K112 Y113 G114 L115 N116 H117 G120 L121 N124 V136 D137 L141 K162 A163 K171 K172 T173 A174 A175 G218 F219 K220 A221 R224
BS02	rna	LG	Y58 I59 Q62 R63 K66 K87 K184 R188	Y34 I35 Q38 R39 K42 K63 K160 R164

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8pv8, PDBe:8pv8, PDBj:8pv8
• PDBsum: 8pv8
• PubMed: 37921038
• UniProt: G0SAJ9