Structure of PDB 8pv4 Chain LG

Receptor sequence

>8pv4LG (length=235) Species: 759272 (Thermochaetoides thermophila DSM 1495)

PKNPLLEKRPRNFGIGQDIQPKRNLSRMVKWPEYIRLQRQKKILRMRLKV
PPAIAQFQYTLDKNLAAQAFKLLNKYRPETKQEKKERLLREATAIKEGKK
KEDVSKKPYTVKYGLNHVVGLIENKKASLVLIANDVDPIELVVFLPALCR
KMGIPYAIIKGKARLGTLVHKKTAAVVAITEVRSEDKNELAKLISAVKEG
YLEKVEDTRKRWGGGIMGFKAQKREEKRKKSLETA

3D structure

• PDB: 8pv4 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Chain: LG
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LG	K26 E31 K32 R33 R35 F37 G38 I39 Q41 Q44 P45 K46 R47 R51 M52 K54 Y58 R60 K66 L68 M70 R71 L72 K73 E103 K108 R111 S129 K130 K131 P132 K136 Y137 G138 L139 H141 G144 L145 N148 D161 L165 K186 A187 K195 K196 A199 G242 F243 K244 A245 K247 R248 R252	K2 E7 K8 R9 R11 F13 G14 I15 Q17 Q20 P21 K22 R23 R27 M28 K30 Y34 R36 K42 L44 M46 R47 L48 K49 E79 K84 R87 S105 K106 K107 P108 K112 Y113 G114 L115 H117 G120 L121 N124 D137 L141 K162 A163 K171 K172 A175 G218 F219 K220 A221 K223 R224 R228
BS02	rna	LG	Y58 I59 Q62 R63 K66 K87 D159 K184 R188	Y34 I35 Q38 R39 K42 K63 D135 K160 R164
BS03	rna	LG	N88 Q92 A215 K216 S219	N64 Q68 A191 K192 S195

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8pv4, PDBe:8pv4, PDBj:8pv4
• PDBsum: 8pv4
• PubMed: 37921038
• UniProt: G0SAJ9