Structure of PDB 8i9v Chain LG

Receptor sequence

>8i9vLG (length=196) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

MVKWPEYIRLQRQKKILRMRLKVPPAIAQFQYTLDKNLAAQAFKLLNKYR
PETKQEKKERLLREATAIKEVSKKPYTVKYGLNHVVGLIENKKASLVLIA
NDVDPIELVVFLPALCRKMGIPYAIIKGKARLGTLVHKKTAAVVAITEVR
SEDKNELAKLISAVKEGYLEKVEDTRKRWGGGIMGFKAQKREEKRK

3D structure

PDB

8i9v Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LG	E103 K108 R111 S129 K130 K131 P132 K136 Y137 G138 N140 H141 G144 L145 V160 P162 L165 K186 A187 K195 K196 A199	E52 K57 R60 S72 K73 K74 P75 K79 Y80 G81 N83 H84 G87 L88 V103 P105 L108 K129 A130 K138 K139 A142
BS02	rna	LG	Y58 I59 Q62 R63 K66 K184 R188	Y7 I8 Q11 R12 K15 K127 R131
BS03	rna	LG	Q92 A215 K216 S219	Q41 A158 K159 S162

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9v, PDBe:8i9v, PDBj:8i9v
PDBsum	8i9v
PubMed	37129998
UniProt	G0SAJ9

[Back to BioLiP]