Structure of PDB 8i9p Chain LG

Receptor sequence

>8i9pLG (length=185) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

MVKWPEYIRLQRQKKILRMRLKVPPAIAQFQYTLDKNLAAQAFKLLNKYR
PETKQEKKERLLREATAIKEVSKKPYTVKYGLNHVVGLIENKKASLVLIA
NDVDPIELVVFLPALCRKMGIPYAIIKGKARLGTLVHKKTAAVVAITEVR
SEDKNELAKLISAVKEGYLEKVEDTRKRWGGGIMG

3D structure

PDB

8i9p Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LG	Y58 K108 R111 K130 K131 P132 K136 Y137 G138 L139 N140 H141 G144 L145 N148 K150 V160 P162 L165 K186 A187 K195 K196 T197 A199	Y7 K57 R60 K73 K74 P75 K79 Y80 G81 L82 N83 H84 G87 L88 N91 K93 V103 P105 L108 K129 A130 K138 K139 T140 A142
BS02	rna	LG	W55 Y58 I59 Q62 R63 K66 N88 Q92 K95 K184 R188 S219	W4 Y7 I8 Q11 R12 K15 N37 Q41 K44 K127 R131 S162
BS03	peptide	LG	D86 K87	D35 K36

Gene Ontology

	Molecular Function
GO:0003723	RNA binding

	Biological Process
GO:0000470	maturation of LSU-rRNA
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9p, PDBe:8i9p, PDBj:8i9p
PDBsum	8i9p
PubMed	37129998
UniProt	G0SAJ9

[Back to BioLiP]