Structure of PDB 7nrd Chain LG

Receptor sequence

>7nrdLG (length=294) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

7nrd Structure of Gcn1 bound to stalled and colliding 80S ribosomes.

Chain

Resolution

4.36 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LG	K8 A11 Y12 R15 F16 R23 G26 T28 Y31 R35 K43 Y44 K48 P139 R140 P141 F142 F145 I148 L150 F160 H175 S176 N178 R179	K5 A8 Y9 R12 F13 R20 G23 T25 Y28 R32 K40 Y41 K45 P136 R137 P138 F139 F142 I145 L147 F157 H172 S173 N175 R176
BS02	rna	LG	K8 S10 S13 S14 T18 F20 R21 R22 R24 E25 K27 T28 Y30 R33 V52 R54 T56 N57 K58 Q63 I65 I69 T70 G71 D72 V73 V74 H90 G91 T93 N94 W95 Q151 R152 T154 T155 R158 H203 Y207 E221 F223 T256 K258 K259 F260 K262 Q264 Y265 A266 E268 S269 K270 Y272 R273 Q274 T275 K276 L277 R282 K289	K5 S7 S10 S11 T15 F17 R18 R19 R21 E22 K24 T25 Y27 R30 V49 R51 T53 N54 K55 Q60 I62 I66 T67 G68 D69 V70 V71 H87 G88 T90 N91 W92 Q148 R149 T151 T152 R155 H200 Y204 E218 F220 T253 K255 K256 F257 K259 Q261 Y262 A263 E265 S266 K267 Y269 R270 Q271 T272 K273 L274 R279 K286

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7nrd, PDBe:7nrd, PDBj:7nrd
PDBsum	7nrd
PubMed	33790014
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]