Structure of PDB 7bhp Chain LG

Receptor sequence

>7bhpLG (length=220) Species: 9606 (Homo sapiens)

KVVNPLFEKRPKNFGIGQDIQPKRDLTRFVKWPRYIRLQRQRAILYKRLK
VPPAINQFTQALDRQTATQLLKLAHKYRPETKQEKKQRLLARAEKRPPVL
RAGVNTVTTLVENKKAQLVVIAHDVDPIELVVFLPALCRKMGVPYCIIKG
KARLGRLVHRKTCTTVAFTQVNSEDKGALAKLVEAIRTNYNDRYDEIRRH
WGGNVLGPKSVARIAKLEKA

3D structure

• PDB: 7bhp Dynamic association of human Ebp1 with the ribosome.
• Chain: LG
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LG	E33 K34 R35 K37 F39 I41 Q43 I45 Q46 P47 R49 L51 R53 F54 K56 P58 R59 Y60 Q66 I69 K72 R73 K75 Q108 K110 R113 R117 K131 R132 G139 N141 T142 D162 L166 A188 R192 R196 K197 T198 T200 P244 K252	E8 K9 R10 K12 F14 I16 Q18 I20 Q21 P22 R24 L26 R28 F29 K31 P33 R34 Y35 Q41 I44 K47 R48 K50 Q83 K85 R88 R92 K95 R96 G103 N105 T106 D126 L130 A152 R156 R160 K161 T162 T164 P208 K216
BS02	rna	LG	R53 W57 Y60 I61 Q64 R65 R89 K185 R189	R28 W32 Y35 I36 Q39 R40 R64 K149 R153

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0045296 cadherin binding

Biological Process

• GO:0000470 maturation of LSU-rRNA
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0045202 synapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7bhp, PDBe:7bhp, PDBj:7bhp
• PDBsum: 7bhp
• PubMed: 33479117
• UniProt: P62424|RL7A_HUMAN Large ribosomal subunit protein eL8 (Gene Name=RPL7A)