Structure of PDB 8rxx Chain LF

Receptor sequence

>8rxxLF (length=149) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

KVSRKSPEYTTLRKSCAPGAIAIILAGRFRGRRAVILKQLPHNGPLVVSG
PMKYNGVPIRRIDSRYVIATSTTVDISSVDTAPITAEVFQRPKAEKPTLV
SDARAQLQKKIDAALIAAIKKDAQGKEKAGYLRSVFTVKPGDAPHRWNW

3D structure

PDB

8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LF	R21 T27 T28 L29 N60 D80 R82 Y83 K110 K113 P114	R4 T10 T11 L12 N43 D63 R65 Y66 K93 K96 P97
BS02	rna	LF	A43 G44 R45 R47 P62 M69 K70 Y71 G73 P75 R77 R78 D80 Y83 R108 T144 L145 V146 S147 Q154 K172 R179 S180 V181 K185 P186	A26 G27 R28 R30 P45 M52 K53 Y54 G56 P58 R60 R61 D63 Y66 R91 T98 L99 V100 S101 Q108 K126 R133 S134 V135 K139 P140

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum	8rxx
PubMed	38722744
UniProt	Q4Q4D3

[Back to BioLiP]