Structure of PDB 8pv4 Chain LF

Receptor sequence

>8pv4LF (length=248) Species: 759272 (Thermochaetoides thermophila DSM 1495)

SSTTVPTQNDILVPETLLKKRKSQEKARAERAAALEKRKQANKEKRQVIF
KRAEKYVKEYREQEREKIRLARIAKQQGSFHIPAEAKLVFVIRIKGINKI
PPKPRKILQLLRLRQINNGVFVKVTKATAEMIKIVEPWVAYGYPNLKSVR
ELIYKRGYGKVNGQRIPLTDNAIIEENLGKYGIICIEDLIHEIFTVGPNF
KQAANFLWPFKLSNPNGGFRPRKFKHFIEGGDLGNREEHINALIRAMN

3D structure

• PDB: 8pv4 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.
• Chain: LF
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LF	S3 T4 T5 T17 L18 K21 K40 R47 R66 I69 R73 K76 K96 G97 N99 K100 P103 K104 K107 I108 L111 R113 Q116 I117 N118 A128 E131 M132 N146 K148 K156 R157 K161 Q165 R166 I167 K202 N206 K212 L213 S214 N215 P216 N217 G218 G219 F220 R223 K224 F225 R246	S2 T3 T4 T16 L17 K20 K39 R46 R65 I68 R72 K75 K95 G96 N98 K99 P102 K103 K106 I107 L110 R112 Q115 I116 N117 A127 E130 M131 N145 K147 K155 R156 K160 Q164 R165 I166 K201 N205 K211 L212 S213 N214 P215 N216 G217 G218 F219 R222 K223 F224 R245

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit

External links

• PDB: RCSB:8pv4, PDBe:8pv4, PDBj:8pv4
• PDBsum: 8pv4
• PubMed: 37921038
• UniProt: G0SFL0