Structure of PDB 8i9y Chain LF

Receptor sequence

>8i9yLF (length=247) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

STTVPTQNDILVPETLLKKRKSQEKARAERAAALEKRKQANKEKRQVIFK
RAEKYVKEYREQEREKIRLARIAKQQGSFHIPAEAKLVFVIRIKGINKIP
PKPRKILQLLRLRQINNGVFVKVTKATAEMIKIVEPWVAYGYPNLKSVRE
LIYKRGYGKVNGQRIPLTDNAIIEENLGKYGIICIEDLIHEIFTVGPNFK
QAANFLWPFKLSNPNGGFRPRKFKHFIEGGDLGNREEHINALIRAMN

3D structure

PDB

8i9y Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LF	T5 T17 L18 K21 K40 N43 R47 R66 I69 R73 K76 K96 G97 N99 K100 P103 K104 K107 I108 L111 R113 R115 Q116 I117 N118 A128 E131 I135 N146 K148 K156 R157 Q165 R166 K202 K212 L213 S214 N215 P216 N217 G218 G219 F220 R223 K224 F225	T3 T15 L16 K19 K38 N41 R45 R64 I67 R71 K74 K94 G95 N97 K98 P101 K102 K105 I106 L109 R111 R113 Q114 I115 N116 A126 E129 I133 N144 K146 K154 R155 Q163 R164 K200 K210 L211 S212 N213 P214 N215 G216 G217 F218 R221 K222 F223

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9y, PDBe:8i9y, PDBj:8i9y
PDBsum	8i9y
PubMed	37129998
UniProt	G0SFL0

[Back to BioLiP]