Structure of PDB 8br8 Chain LF

Receptor sequence

>8br8LF (length=293) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

GWVKVQKTRSYFKRFQVQFRRRREGKTDYQARKALIIQDKNKYATPRYRF
VVRRTNKDIICQVTAAELTKDRVVCAAYSHELPRYGIPVGLTNYAAAYAT
GLLCGRRLLEKLSVGIKENALAQLYPGLDKATGEEYHPDENENEEVHAFK
AFLDIGLARASTGARVFAAMKGAVDAGLNIPHSMKRFPGYSKDGFDSSAL
RDRIMGKHVGDYMAELKAEDEETYRKRFSKYIAAKVEPLRLEAMYTKAHA
AIRANPQAVKAKFEIKKPVRQARLTLKERKERIDAKKLEALKQ

3D structure

PDB

8br8 Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.35 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LF	K8 R10 F13 K14 F16 V18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 I61 Q63 T70 K71 D72 R73 V74 Y79 N94 Y95 R160 S162 T163 G164 A165 R166 R204 H209 V210 Y213 R228 F229 S230 K231 Y232 K261 A262 F264 E265 I266 K267 K268 R271 Q272 R274 L275 L277 R280 R283 K287	K7 R9 F12 K13 F15 V17 F19 R20 R21 R23 K26 T27 Y29 R32 R49 R53 T55 N56 K57 I60 Q62 T69 K70 D71 R72 V73 Y78 N93 Y94 R159 S161 T162 G163 A164 R165 R203 H208 V209 Y212 R227 F228 S229 K230 Y231 K260 A261 F263 E264 I265 K266 K267 R270 Q271 R273 L274 L276 R279 R282 K286
BS02	rna	LF	G2 W3 V4 K5 Q7 K8 S11 Y12 K14 R15 F16 Q17 Q19 R23 G26 T28 D29 Q31 A35 L36 K43 Y44 R48 Y49 V147 H148 F150 F153 L154 I156 L158 R160 F168 P182 S184 K186 R187	G1 W2 V3 K4 Q6 K7 S10 Y11 K13 R14 F15 Q16 Q18 R22 G25 T27 D28 Q30 A34 L35 K42 Y43 R47 Y48 V146 H147 F149 F152 L153 I155 L157 R159 F167 P181 S183 K185 R186

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0008097	5S rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8br8, PDBe:8br8, PDBj:8br8
PDBsum	8br8
PubMed	36912103
UniProt	E2RU47

[Back to BioLiP]