Structure of PDB 4v3p Chain LF

Receptor sequence

>4v3pLF (length=190) Species: 4565 (Triticum aestivum)

MKTILASETMEIPEGVTVQVAAKVVTVEGPRGKLTRNFKHLNLDFQLLEG
GRKLQVDAWFGTRRTMAAIRTAISHVQNLITGVTKGYRYKMRFVYAHFPI
NASITNSNTAIEIRNFLGEKKVRKVDMLEGVTILRSEKVKDELVLDGNDI
ELVSRSAALINQKCHVKNKDIRKFLDGIYVSDKGTITEDA

3D structure

• PDB: 4v3p The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.
• Chain: LF
• Resolution: 34.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LF	M1 N42 W59 R63 R64 A67 R70 T71 H97 F98 L117 E119 K120 K121 S154 R155 L159 Q162 H165 K167 K169 D170 I171 R172 K173 K183	M1 N42 W59 R63 R64 A67 R70 T71 H97 F98 L117 E119 K120 K121 S154 R155 L159 Q162 H165 K167 K169 D170 I171 R172 K173 K183

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 08:53:32 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v3p', asym_id = 'LF', title = 'The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v3p', asym_id='LF', title='The molecular structure of the left-handed supra-molecular helix of eukaryotic polyribosomes.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412,0019843', uniprot = '', pdbid = '4v3p', asym_id = 'LF'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412,0019843', uniprot='', pdbid='4v3p', asym_id='LF')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>