Structure of PDB 8y0w Chain LE

Receptor sequence

>8y0wLE (length=232) Species: 9606 (Homo sapiens) [Search protein sequence]

PHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYSAALATVTKPVGDKNGGT
RVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILT
GRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKIDIS
NVKIPKHLTDAYFKKKKLPRHQEGEIFDTEKEKYEITEQRKIDQKAVDSQ
ILPKIKAIPQLQGYLRSVFALTNGIYPHKLVF

3D structure

PDB

8y0w dormant ribosome with eIF5A, eEF2 and SERBP1

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LE	H43 C44 S45 R46 N47 V51 R52 S58 R59 S60 M62 Y63 S64 R65 K66 A67 Y69 K70 R71 K72 Y73 L89 A90 T91 K94 P95 G97 D99 K100 N101 R105 K108 R110 K111 P113 R114 Y115 R123 K124 L125 L126 H128 K130 P132 F133 S134 H136 T154 R156 H157 R158 L172 L179 L181 R183 P185 R187 R188 H190 K192 F217 K219 Q228 Y240 I242 Q250 Q266 R272 S273 N279	H2 C3 S4 R5 N6 V10 R11 S17 R18 S19 M21 Y22 S23 R24 K25 A26 Y28 K29 R30 K31 Y32 L36 A37 T38 K41 P42 G44 D45 K46 N47 R51 K54 R56 K57 P59 R60 Y61 R69 K70 L71 L72 H74 K76 P78 F79 S80 H82 T100 R102 H103 R104 L118 L125 L127 R129 P131 R133 R134 H136 K138 F163 K165 Q172 Y184 I186 Q194 Q210 R216 S217 N223

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045296	cadherin binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006355	regulation of DNA-templated transcription
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0014069	postsynaptic density
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8y0w, PDBe:8y0w, PDBj:8y0w
PDBsum	8y0w
PubMed	38698775
UniProt	Q02878\|RL6_HUMAN Large ribosomal subunit protein eL6 (Gene Name=RPL6)

[Back to BioLiP]