Structure of PDB 8rxh Chain LE

Receptor sequence

>8rxhLE (length=186) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

VKVKSLCTLQIPEGVTVDVKGRKVTVTGKRGTLTKDLTHLQLDLRVDKKN
RTFTVIRWFGSKIPIACLNTTKAHVQNMITGVTKGYRFKVRCAYAHFPIN
VSVDGQNIEVRNFLGEKRVRRQLVPNTVKVSQTDPSKVKDEIVFDGNDLE
QVSREAAVLHQMCLVKKKDIRKFLDGIYVQTKTNIE

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LE	S62 K63 I64	S61 K62 I63
BS02	rna	LE	K167 K169 D170 R172 F174	K166 K168 D169 R171 F173
BS03	rna	LE	H40 A67 N70 T71 A74 H75 N78 H97 F98 E117 K118 R119 L150 E151 S154 R155 Q162 K169 K173 F174	H39 A66 N69 T70 A73 H74 N77 H96 F97 E116 K117 R118 L149 E150 S153 R154 Q161 K168 K172 F173
BS04	rna	LE	K5 R23 Q42 L43 D44 R46 D48 K50 R58 W59	K4 R22 Q41 L42 D43 R45 D47 K49 R57 W58

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum	8rxh
PubMed	38722744
UniProt	Q4QC91

[Back to BioLiP]