Structure of PDB 8pv5 Chain LE

Receptor sequence

>8pv5LE (length=191) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

AAPTTKTFGKGTRTVPAPSEKAQKWYPAEDEAQPKKVRKAVRPWTPRKSL
QPGTVLILLAGRFRGKRVVLLKCLDQGVLLVTGPFKINGVPLRRVNARYV
IATSVKVDLTGVDQAKIDEVAQPKYFTAEKAKEKASEEKPQKKPVSSTRA
ADQKAIDKALIANIKKVDMLASYLASSFSLRKGDKPHLMKF

3D structure

PDB

8pv5 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.86 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LE	K8 T9 F10 R15 V17 K26 Q35 P36 K37 K38 V39 R40 K41 A42 R44 W46 A62 G63 R64 R66 Q78 V80 F87 K88 G91 P93 R95 R96 R100 Y101 K132 E135 K151 K152 V154 R158 S185 S186 R190 K191	K6 T7 F8 R13 V15 K24 Q33 P34 K35 K36 V37 R38 K39 A40 R42 W44 A60 G61 R62 R64 Q76 V78 F85 K86 G89 P91 R93 R94 R98 Y99 K130 E133 K142 K143 V145 R149 S176 S177 R181 K182

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv5, PDBe:8pv5, PDBj:8pv5
PDBsum	8pv5
PubMed	37921038
UniProt	G0S0D6

[Back to BioLiP]