Structure of PDB 8oo0 Chain LE

Receptor sequence

>8oo0LE (length=194) Species: 209285 (Thermochaetoides thermophila) [Search protein sequence]

TKTFGKGTRTVPAPSEKAQKWYPAEDEAQPKKVRKAVRPWTPRKSLQPGT
VLILLAGRFRGKRVVLLKCLDQGVLLVTGPFKINGVPLRRVNARYVIATS
VKVDLTGVDQAKIDEVAQPKYFTAEKAKEKASEEAFFKQGEKPQKKPVSS
TRAADQKAIDKALIANIKKVDMLASYLASSFSLRKGDKPHLMKF

3D structure

PDB

8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LE	Q35 P36 K37 V39 R40 K41 A42 R44 W46 R64 Q78 V80 F87 K88 G91 P93 R95 R96 N98 R100 K132 E135 K136 K151 K152 V154 R158 S185 S186 R190 K191	Q29 P30 K31 V33 R34 K35 A36 R38 W40 R58 Q72 V74 F81 K82 G85 P87 R89 R90 N92 R94 K126 E129 K130 K145 K146 V148 R152 S179 S180 R184 K185

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
PDBsum	8oo0
PubMed	38267453
UniProt	G0S0D6

[Back to BioLiP]