Structure of PDB 8k82 Chain LE

Receptor sequence

>8k82LE (length=157) Species: 4932 (Saccharomyces cerevisiae)

SAQKAPKWYPSEDVAALKKTRKAARPQKLRASLVPGTVLILLAGRFRGKR
VVYLKHLEDNTLLISGPFKVNGVPLRRVNARYVIATSTKVSVEGVNVEKF
NVEYFAKEKEIKAERVEDQKVVDKALIAEIKKTPLLKQYLSASFSLKNGD
KPHMLKF

3D structure

• PDB: 8k82 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: LE
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LE	S2 K5 W9 A16 A17 K19 T21 R22 K23 A24 R26 Q28 K29 A44 G45 R46 F47 N61 T62 F69 N72 G73 R77 R78 N80 R82 Y83 K108 K128 I130 S162 K166 N167	S1 K4 W8 A15 A16 K18 T20 R21 K22 A23 R25 Q27 K28 A43 G44 R45 F46 N60 T61 F68 N71 G72 R76 R77 N79 R81 Y82 K107 K109 I111 S143 K147 N148

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k82, PDBe:8k82, PDBj:8k82
• PDBsum: 8k82
• PubMed: 38942792
• UniProt: Q02326|RL6A_YEAST Large ribosomal subunit protein eL6A (Gene Name=RPL6A)