Structure of PDB 8k2c Chain LE

Receptor sequence

>8k2cLE (length=221) Species: 9606 (Homo sapiens) [Search protein sequence]

PHCSRNPVLVRGIGRYSRSAMYSRKAMYKRKYSAAVLATVTKPVGGDKNG
GTRVVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILII
LTGRHRGKRVVFLKQLASGLLLVTGPLVLNRVPLRRTHQKFVIATSTKID
ISNVKIPKHLTDAYFKKKKKEKYEITEQRKIDQKAVDSQILPKIKAIPQL
QGYLRSVFALTNGIYPHKLVF

3D structure

PDB

8k2c Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LE	H43 C44 S45 R46 V51 R52 S58 R59 S60 M62 Y63 R65 K66 A67 Y69 K70 R71 K72 Y73 V88 L89 A90 T91 K94 P95 G97 D99 K100 N101 R105 V107 K108 R110 K111 M112 P113 R114 Y115 V121 R123 K124 L125 L126 S127 H128 G129 K130 P132 F133 S134 H136 K139 T154 R156 H157 R158 L172 L179 L181 R183 P185 R187 R188 H190 K192 F193 F217 K218 K219 Y240 I242 K262 Q266 Q268 R272 S273 N279	H2 C3 S4 R5 V10 R11 S17 R18 S19 M21 Y22 R24 K25 A26 Y28 K29 R30 K31 Y32 V36 L37 A38 T39 K42 P43 G45 D47 K48 N49 R53 V55 K56 R58 K59 M60 P61 R62 Y63 V69 R71 K72 L73 L74 S75 H76 G77 K78 P80 F81 S82 H84 K87 T102 R104 H105 R106 L120 L127 L129 R131 P133 R135 R136 H138 K140 F141 F165 K166 K167 Y173 I175 K195 Q199 Q201 R205 S206 N212

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0045296	cadherin binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006355	regulation of DNA-templated transcription
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0005925	focal adhesion
GO:0014069	postsynaptic density
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8k2c, PDBe:8k2c, PDBj:8k2c
PDBsum	8k2c
PubMed	38942792
UniProt	Q02878\|RL6_HUMAN Large ribosomal subunit protein eL6 (Gene Name=RPL6)

[Back to BioLiP]