Structure of PDB 8fle Chain LE

Receptor sequence

>8fleLE (length=154) Species: 9606 (Homo sapiens) [Search protein sequence]

TNTKGKRRGTRYMFSRPFRKHGVVPLATYMRIYKKGDIVDIKGMGTVQKG
MPHKCYHGKTGRVYNVTQHAVGIVVNKQVKGKILAKRINVRIEHIKHSKS
RDSFLKRVKENDQKKKEAKEWVQLKRQPAPPREAHFVRTNGKEPELLEPI
PYEF

3D structure

PDB

8fle Principles of human pre-60S biogenesis

Chain

Resolution

2.48 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LE	T2 N3 T4 K5 G6 K7 R8 R9 G10 R12 Y13 S16 F19 H22 G23 K35 D41 K43 Q49 G51 H54 K55 Y57 H58 K60 T61 T68 Q69 H70 A71 K78 V80 K81 L85 K87 R88 S101 F105 V109 N112 D113 W125 V126 L128 K129 R130 P132 F140 R142	T1 N2 T3 K4 G5 K6 R7 R8 G9 R11 Y12 S15 F18 H21 G22 K34 D40 K42 Q48 G50 H53 K54 Y56 H57 K59 T60 T67 Q68 H69 A70 K77 V79 K80 L84 K86 R87 S100 F104 V108 N111 D112 W121 V122 L124 K125 R126 P128 F136 R138
BS02	rna	LE	R20 P26 A28	R19 P25 A27

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0016020	membrane
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8fle, PDBe:8fle, PDBj:8fle
PDBsum	8fle
PubMed	37410842
UniProt	P46778\|RL21_HUMAN Large ribosomal subunit protein eL21 (Gene Name=RPL21)

[Back to BioLiP]