Structure of PDB 7cpu Chain LE

Receptor sequence

>7cpuLE (length=231) Species: 10090 (Mus musculus) [Search protein sequence]

PHCSRNPVLVRGIGRYSRSAMYSRKALYKRKLATVTKTVGGDKNGGTRVV
KLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRRLRSSITPGTVLIILTGRH
RGKRVVFLKQLDSGLLLVTGPLVINRVPLRRTHQKFVIATSTKVDISDVK
IPKHLTDAYFKKKQLRKPRHQEGEIFDTEKEKYEITEQRKADQKAVDLQI
LPKIKAVPQLQGYLRSQFSLTNGMYPHKLVF

3D structure

PDB

7cpu A male germ-cell-specific ribosome controls male fertility.

Chain

Resolution

2.82 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LE	P49 H50 C51 S52 R53 N54 V58 R59 R63 S65 R66 S67 M69 R72 K73 A74 Y76 K77 R78 A98 T99 K102 T103 G105 D107 K108 N109 R113 V115 K116 K119 P121 R122 Y123 P130 R131 K132 L133 L134 S135 H136 K138 K139 P140 F141 S142 H144 V145 R147 T162 G163 R164 H165 R166 L180 L187 I189 R191 P193 R195 R196 H198 K200 F201 F225 K227 K247 Y248 I250 R254 K255 P273 Q274 Q276 R280 N287	P1 H2 C3 S4 R5 N6 V10 R11 R15 S17 R18 S19 M21 R24 K25 A26 Y28 K29 R30 A33 T34 K37 T38 G40 D42 K43 N44 R48 V50 K51 K54 P56 R57 Y58 P65 R66 K67 L68 L69 S70 H71 K73 K74 P75 F76 S77 H79 V80 R82 T97 G98 R99 H100 R101 L115 L122 I124 R126 P128 R130 R131 H133 K135 F136 F160 K162 K182 Y183 I185 R189 K190 P208 Q209 Q211 R215 N222

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0140236	translation at presynapse
GO:0140242	translation at postsynapse

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005783	endoplasmic reticulum
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0014069	postsynaptic density
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0036464	cytoplasmic ribonucleoprotein granule
GO:0045202	synapse
GO:0098793	presynapse
GO:0098794	postsynapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7cpu, PDBe:7cpu, PDBj:7cpu
PDBsum	7cpu
PubMed	36517592
UniProt	P47911\|RL6_MOUSE Large ribosomal subunit protein eL6 (Gene Name=Rpl6)

[Back to BioLiP]