Structure of PDB 8rxh Chain LD

Receptor sequence

>8rxhLD (length=175) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

SKAANPMREIVVKKLCINICVGESGDRLTRASKVLEQLCEQTPVLSRARL
TVRTFGIRRNEKIAVHCTVRGKKAEELLEKGLKVKEFELKSYNFADTGSF
GFGIDEHIDLGIKYDPSTGIYGMDFYVVLGRRGERVAHRKRKCSRVGHSH
HVTKEEAMKWFEKVHDGIIFQAKKK

3D structure

PDB

8rxh Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.93 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LD	K18 C20 N22 C24 G26 S50 A52 R53 F59 I61 I67 H70 Y96 N97 A99 D100 T101 G105 F106 G107 G126 D128 Y130 K144	K14 C16 N18 C20 G22 S46 A48 R49 F55 I57 I63 H66 Y92 N93 A95 D96 T97 G101 F102 G103 G122 D124 Y126 K140
BS02	rna	LD	K6 N9 M11 R12 Q45 T46 V48 T72 R74 R136 G137 R139 R143 K144 R145 K146 S148 R149 V150 G151 H154	K2 N5 M7 R8 Q41 T42 V44 T68 R70 R132 G133 R135 R139 K140 R141 K142 S144 R145 V146 G147 H150

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxh, PDBe:8rxh, PDBj:8rxh
PDBsum	8rxh
PubMed	38722744
UniProt	P48157\|RL11_LEIMA Large ribosomal subunit protein uL5 (Gene Name=RPL11)

[Back to BioLiP]