Structure of PDB 6z6k Chain LD

Receptor sequence

>6z6kLD (length=294) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

QKDAKSSAYSSRFQTPFRRRREGKTDYYQRKRLVTQHKAKYNTPKYRLVV
RFTNKDIICQIISSTITGDVVLAAAYSHELPRYGITHGLTNWAAAYATGL
LIARRTLQKLGLDETYKGVEEVEGEYELTEAVEDGPRPFKVFLDIGLQRT
TTGARVFGALKGASDGGLYVPHSENRFPGWDFETEEIDPELLRSYIFGGH
VSQYMEELADDDEERFSELFKGYLADDIDADSLEDIYTSAHEAIRADPAF
KPTEKKFTKEQYAAESKKYRQTKLSKEERAARVAAKIAALAGQQ

3D structure

PDB

6z6k Structure and function of yeast Lso2 and human CCDC124 bound to hibernating ribosomes.

Chain

Resolution

3.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LD	Y12 R15 F16 Q17 R23 T28 D29 Y31 R35 L36 K43 K48 R140 P141 F145 L146 I148 L150 T153 F160 P174 H175 S176 R179	Y9 R12 F13 Q14 R20 T25 D26 Y28 R32 L33 K40 K45 R137 P138 F142 L143 I145 L147 T150 F157 P171 H172 S173 R176
BS02	rna	LD	K8 S10 S13 S14 F16 T18 F20 R21 R22 R24 K27 T28 Y30 R33 R50 R54 T56 N57 K58 D59 Q63 I69 T70 D72 V74 Y79 H90 G91 N94 W95 Q151 R152 T154 T155 G156 R158 Y198 H203 Y207 R218 E221 L222 K224 T256 K258 K259 F260 Y265 A266 E268 S269 K270 Y272 R273 Q274 K276 K279 R282 K289	K5 S7 S10 S11 F13 T15 F17 R18 R19 R21 K24 T25 Y27 R30 R47 R51 T53 N54 K55 D56 Q60 I66 T67 D69 V71 Y76 H87 G88 N91 W92 Q148 R149 T151 T152 G153 R155 Y195 H200 Y204 R215 E218 L219 K221 T253 K255 K256 F257 Y262 A263 E265 S266 K267 Y269 R270 Q271 K273 K276 R279 K286

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6z6k, PDBe:6z6k, PDBj:6z6k
PDBsum	6z6k
PubMed	32687489
UniProt	P26321\|RL5_YEAST Large ribosomal subunit protein uL18 (Gene Name=RPL5)

[Back to BioLiP]