Structure of PDB 5wlc Chain LD

Receptor sequence
>5wlcLD (length=127) Species: 1247190 (Saccharomyces cerevisiae BY4741) [Search protein sequence]
TVQSERAFQKQPHITKRWYKNAGLGFKTPKTAIEGSYIDKKCPFTGLVSI
RGKILTGTVVSTKMHRTIVIRRAYLHYIPKYNRYEKRHKNVPVHVSPAFR
VQVGDIVTVGQCRPISKTVRFNVVKVS
3D structure
PDB5wlc The complete structure of the small-subunit processome.
ChainLD
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LD E10 Q14 K56 K57 S65 R67 S77 M80 H81 R82 T83 K102 R103 H104 K105 N106 Q127 R129 I131 S132 K133 T134 R136 E5 Q9 K40 K41 S49 R51 S61 M64 H65 R66 T67 K86 R87 H88 K89 N90 Q111 R113 I115 S116 K117 T118 R120
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:0030686 90S preribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5wlc, PDBe:5wlc, PDBj:5wlc
PDBsum5wlc
PubMed28945246
UniProtP0CX47|RS11A_YEAST Small ribosomal subunit protein uS17A (Gene Name=RPS11A)

[Back to BioLiP]