Structure of PDB 8p5d Chain LC0

Receptor sequence

>8p5dLC0 (length=327) Species: 1358809 (Spraguea lophii 42_110)

SRQVNIIEQDGTSSRTTSVPAVFNLNVRQDLISFTHKNVAMNSRQPYAVK
PGAGMRHSAKSWGTGRAMARVPRVRAGGTRRAGQGANANFCRGGRMFAPT
NVNRRWNRKTLLSIRRYASAMAVAATSIPAYVEGRGHRIEQIENIPLVLS
NKIDTEKTKEGIKILYNLGLKEELDKVEESKNIRAGKGKWRNRRYVLKKG
PLFVYTSETSFTKAIRNIPGVDTERVENLSILDLAPGGQAGRLIIWMEDA
FEKLTEIYGEMNEESKFKKGYTMGMDVAENIDVENIFYSDEVQEFIDIPN
FIKKDKMVMEKNKLAEIQQYVEIEERI

3D structure

• PDB: 8p5d Spraguea lophii ribosome
• Chain: LC0
• Resolution: 10.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LC0	K38 M42 N43 Q46 P47 Y48 A49 V50 K51 M56 R57 H58 S59 T65 G66 A68 M69 R71 P73 R76 G78 G79 T80 R82 Q85 N90 F91 R93 G94 R96 M97 F98 N104 R105 R106 K110 T111 L112 S114 I115 R116 R117 R136 K158 T159 K160 I163 R185 G187 K188 K190 W191 R192 R194 K199 K200 K214 R217 N218 P220 N229 G238 K269 K270	K37 M41 N42 Q45 P46 Y47 A48 V49 K50 M55 R56 H57 S58 T64 G65 A67 M68 R70 P72 R75 G77 G78 T79 R81 Q84 N89 F90 R92 G93 R95 M96 F97 N103 R104 R105 K109 T110 L111 S113 I114 R115 R116 R135 K157 T158 K159 I162 R184 G186 K187 K189 W190 R191 R193 K198 K199 K213 R216 N217 P219 N228 G237 K268 K269

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8p5d, PDBe:8p5d, PDBj:8p5d
• PDBsum: 8p5d
• PubMed: 37709902
• UniProt: S7WCM8