Structure of PDB 8xt1 Chain LC

Receptor sequence

>8xt1LC (length=304) Species: 9606 (Homo sapiens) [Search protein sequence]

SGTWWDEHLSEENVPFIKQLVSDEDKAQLASKLCPLKDEPWPIHPWEPGS
FRVGLIALKLGMMPLWTKDGQKHVVTLLQVQDCHVLKYTSKENCNGKMAT
LSVGGKTVSRFRKATSILEFYRELGLPPKQTVKIFNITDNAAIKPGTPLY
AAHFRPGQYVDVTAKTIGKGFQGVMKRWGFKGQPATHGQTKTHRRPGAVA
TGDIGRVWPGTKMPGKMGNIYRTEYGLKVWRINTKHNIIYVNGSVPGHKN
CLVKVKDSKLPAYKDLGKNLPFPTYFPDGDEEELPEDLYDENVCQPGAPS
ITFA

3D structure

PDB

8xt1 Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LC	G46 T47 W48 W49 V65 D69 M106 P108 K116 V118 K141 S153 F155 R156 A158 I161 Y165 V176 K177 I178 T207 T210 I211 G212 K213 G214 F215 G217 K220 R221 F224 K225 G226 P228 T230 H231 G232 Q233 T234 K235 T236 H237 R238 R239 G241 A242 V243 A244 T245 G246 D247 I248 G249 R250 V251 W252 P253 G254 T255 M257 P258 K260 N263 I264 Y265 R266 E268 Y269 N286 S288 V289 G291 H292 K293 N294 K298 K300 K303	G2 T3 W4 W5 V21 D25 M62 P64 K72 V74 K97 S109 F111 R112 A114 I117 Y121 V132 K133 I134 T163 T166 I167 G168 K169 G170 F171 G173 K176 R177 F180 K181 G182 P184 T186 H187 G188 Q189 T190 K191 T192 H193 R194 R195 G197 A198 V199 A200 T201 G202 D203 I204 G205 R206 V207 W208 P209 G210 T211 M213 P214 K216 N219 I220 Y221 R222 E224 Y225 N242 S244 V245 G247 H248 K249 N250 K254 K256 K259

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005762	mitochondrial large ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8xt1, PDBe:8xt1, PDBj:8xt1
PDBsum	8xt1
PubMed	38942792
UniProt	P09001\|RM03_HUMAN Large ribosomal subunit protein uL3m (Gene Name=MRPL3)

[Back to BioLiP]