Structure of PDB 8rxx Chain LC

Receptor sequence

>8rxxLC (length=366) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

RPSVSVYSASSDSVVGTCPLPAVFTAPIRSDIVKFVHTNMAKNSRQAYAV
NRLSGMNHSAHSWGTGRAVARIPRISGGGTSTSGAGAFGNMCRGGRMFAP
TKIFRRWHRKINLHQKRFAVVSALAASSVPSLVMSRGHQIGNVPEVPLVV
EDSIQGYEKTKEAMAFLKAIAAIDDVNRVNDSREIRAGRGKMRNRRYVAR
RGPMLVMPNNKGTRAFRNIFGLDLANVSALNLLHLAPGGHVGRFVIWTQS
AFEQLDKIFGTFTEASAVKKGFTLPAPMLTNTDVTRIMQSEEVRRVLKPK
KLQAKKASRFQTPTNGMKNRRLRLRLNPYVKRETAAAKGMRNVANRDARR
KAKLARVTKAKKAATK

3D structure

PDB

8rxx Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.97 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	LC	R32 F38 T41 M43 A44 K45 N46 R48 Q49 Y51 V53 N54 R55 S57 M59 H61 S62 T68 V72 R74 P76 S79 G81 G82 T83 T85 G89 N93 M94 C95 R96 G97 R99 M100 F101 A102 P103 K105 F107 R108 R109 K113 N115 H117 Q118 K119 R120 R139 N145 K162 T163 R181 E187 I188 R189 A190 G191 R192 K194 R196 N197 R198 Y200 R203 R204 N213 R217 N221 N234 G241 H243 V271 K272 K273 R297 K301 K303 K304 L305 Q306 K308 K309 S311 R312 F313 Q314 P316 T317 N318 N322 R323 R324 R326 L327 R328 Y332 K334 R335 T337 A340 K341 G342 M343 R344 N348 R352 R353 K356 L357 R359 A363 K364 A366	R29 F35 T38 M40 A41 K42 N43 R45 Q46 Y48 V50 N51 R52 S54 M56 H58 S59 T65 V69 R71 P73 S76 G78 G79 T80 T82 G86 N90 M91 C92 R93 G94 R96 M97 F98 A99 P100 K102 F104 R105 R106 K110 N112 H114 Q115 K116 R117 R136 N142 K159 T160 R178 E184 I185 R186 A187 G188 R189 K191 R193 N194 R195 Y197 R200 R201 N210 R214 N218 N231 G238 H240 V268 K269 K270 R294 K298 K300 K301 L302 Q303 K305 K306 S308 R309 F310 Q311 P313 T314 N315 N319 R320 R321 R323 L324 R325 Y329 K331 R332 T334 A337 K338 G339 M340 R341 N345 R349 R350 K353 L354 R356 A360 K361 A363
BS02	rna	LC	T68 G69 R70 A71 R74	T65 G66 R67 A68 R71
BS03	rna	LC	A50 A52 M195	A47 A49 M192

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8rxx, PDBe:8rxx, PDBj:8rxx
PDBsum	8rxx
PubMed	38722744
UniProt	E9ADW5

[Back to BioLiP]