Structure of PDB 8pv3 Chain LC

Receptor sequence

>8pv3LC (length=363) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

SRPTVTVFGADGKPTGATEVLPKVFSAPIRPDIVKHVHTGMAKNKRQPYA
VSEKAGHQTSAESWGTGRAVARIPRVSGGGTHRAGQGAFGNMCRSGRMFA
PTKIWRKWHVKINQGQKRFATASALAASAVAPLLMARGHQVSTVPEVPLV
VDSAAVAGDAVAKTAAAYKLLKAIGAGPDVEKVKKSKKLRAGKGKMRGRR
HRQRRGPLIVYSPEHDGKELVKGFRNIPGVETCPVDALNLLQLAPGGHLG
RFIVWTSAAIKQLDAVYESKKGFFLPANIVSQADLSRLINSTEIQSVLRA
PKGEARTKRACVQKKNPLRNKQIMLRLNPYASTFAKEKLGEVKAEEGKPP
KVPASFKELLHEA

3D structure

PDB

8pv3 Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.8 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LC	R32 I35 H38 T41 A44 K45 N46 K47 R48 Q49 Y51 V53 S54 A57 H59 Q60 T61 S62 T68 G69 R70 V72 A73 R74 I75 P76 G81 G82 T83 H84 R85 Q88 N93 M94 R96 S97 R99 M100 F101 A102 P103 K105 W107 R108 K109 K113 I114 N115 Q116 Q118 K119 R120 R139 Q142 K165 T166 K187 K190 L191 R192 A193 G194 K195 K197 M198 R199 R201 R204 R206 R207 Y213 K220 V223 K224 R227 N228 T234 D238 N241 P247 G248 H250 K272 K273 S288 I291 N292 T294 Q297 P303 K304 G305 E306 R308 T309 K310 R311 A312 V314 Q315 K317 R321 N322 K323 Q324 R328 E343 V344 K345 E348 G349 K350 P351 V354 F358 L362 H363	R30 I33 H36 T39 A42 K43 N44 K45 R46 Q47 Y49 V51 S52 A55 H57 Q58 T59 S60 T66 G67 R68 V70 A71 R72 I73 P74 G79 G80 T81 H82 R83 Q86 N91 M92 R94 S95 R97 M98 F99 A100 P101 K103 W105 R106 K107 K111 I112 N113 Q114 Q116 K117 R118 R137 Q140 K163 T164 K185 K188 L189 R190 A191 G192 K193 K195 M196 R197 R199 R202 R204 R205 Y211 K218 V221 K222 R225 N226 T232 D236 N239 P245 G246 H248 K270 K271 S286 I289 N290 T292 Q295 P301 K302 G303 E304 R306 T307 K308 R309 A310 V312 Q313 K315 R319 N320 K321 Q322 R326 E341 V342 K343 E346 G347 K348 P349 V352 F356 L360 H361
BS02	rna	LC	P50 A52 S54 I106 K197 M198	P48 A50 S52 I104 K195 M196

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pv3, PDBe:8pv3, PDBj:8pv3
PDBsum	8pv3
PubMed	37921038
UniProt	G0SFC3

[Back to BioLiP]