Structure of PDB 8oo0 Chain LC

Receptor sequence

>8oo0LC (length=363) Species: 209285 (Thermochaetoides thermophila)

SRPTVTVFGADGKPTGATEVLPKVFSAPIRPDIVKHVHTGMAKNKRQPYA
VSEKAGHQTSAESWGTGRAVARIPRVSGGGTHRAGQGAFGNMCRSGRMFA
PTKIWRKWHVKINQGQKRFATASALAASAVAPLLMARGHQVSTVPEVPLV
VDSAAVAGDAVAKTAAAYKLLKAIGAGPDVEKVKKSKKLRAGKGKMRGRR
HRQRRGPLIVYSPEHDGKELVKGFRNIPGVETCPVDALNLLQLAPGGHLG
RFIVWTSAAIKQLDAVYESKKGFFLPANIVSQADLSRLINSTEIQSVLRA
PKGEARTKRACVQKKNPLRNKQIMLRLNPYASTFAKEKLGEVKAEEGKPP
KVPASFKELLHEA

3D structure

• PDB: 8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
• Chain: LC
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LC	M43 N46 Q49 Y51 S54 H59 Q60 T61 S62 T68 G69 V72 R74 P76 G82 T83 R85 Q88 N93 M94 R96 S97 R99 F101 K105 R108 K113 N115 Q116 Q118 R120 R139 T166 K187 K190 R192 A193 K195 R199 R201 R206 R207 Y213 K224 R227 N228 T234 G248 K273 I291 T294 P303 G305 E306 K310 R311 V314 Q315 K317 R321 K323 R328 E343 K345 P351	M41 N44 Q47 Y49 S52 H57 Q58 T59 S60 T66 G67 V70 R72 P74 G80 T81 R83 Q86 N91 M92 R94 S95 R97 F99 K103 R106 K111 N113 Q114 Q116 R118 R137 T164 K185 K188 R190 A191 K193 R197 R199 R204 R205 Y211 K222 R225 N226 T232 G246 K271 I289 T292 P301 G303 E304 K308 R309 V312 Q313 K315 R319 K321 R326 E341 K343 P349
BS02	rna	LC	P50 K197 M198	P48 K195 M196

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
• PDBsum: 8oo0
• PubMed: 38267453
• UniProt: G0SFC3