Structure of PDB 8i9y Chain LC

Receptor sequence

>8i9yLC (length=362) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

RPTVTVFGADGKPTGATEVLPKVFSAPIRPDIVKHVHTGMAKNKRQPYAV
SEKAGHQTSAESWGTGRAVARIPRVSGGGTHRAGQGAFGNMCRSGRMFAP
TKIWRKWHVKINQGQKRFATASALAASAVAPLLMARGHQVSTVPEVPLVV
DSAAVAGDAVAKTAAAYKLLKAIGAGPDVEKVKKSKKLRAGKGKMRGRRH
RQRRGPLIVYSPEHDGKELVKGFRNIPGVETCPVDALNLLQLAPGGHLGR
FIVWTSAAIKQLDAVYESKKGFFLPANIVSQADLSRLINSTEIQSVLRAP
KGEARTKRACVQKKNPLRNKQIMLRLNPYASTFAKEKLGEVKAEEGKPPK
VPASFKELLHEA

3D structure

PDB

8i9y Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LC	R32 I35 K37 H38 T41 M43 K45 N46 K47 R48 Q49 Y51 V53 S54 H59 Q60 T61 S62 R70 V72 A73 R74 P76 G82 T83 R85 Q88 N93 M94 C95 R96 S97 R99 M100 F101 A102 P103 W107 R108 K113 I114 N115 Q116 Q118 K119 R120 R139 T166 K190 L191 R192 A193 G194 K195 K197 M198 R199 R201 R204 R206 R207 Y213 K224 R227 N228 T234 L240 N241 P247 G248 H250 K272 K273 F276 S288 I291 N292 T294 Q297 P303 K304 G305 E306 A307 R308 T309 K310 R311 A312 V314 Q315 K317 R321 N322 K323 Q324 R328 G342 E343 V344 K345 E348 G349 K350 P351 F358 L362	R29 I32 K34 H35 T38 M40 K42 N43 K44 R45 Q46 Y48 V50 S51 H56 Q57 T58 S59 R67 V69 A70 R71 P73 G79 T80 R82 Q85 N90 M91 C92 R93 S94 R96 M97 F98 A99 P100 W104 R105 K110 I111 N112 Q113 Q115 K116 R117 R136 T163 K187 L188 R189 A190 G191 K192 K194 M195 R196 R198 R201 R203 R204 Y210 K221 R224 N225 T231 L237 N238 P244 G245 H247 K269 K270 F273 S285 I288 N289 T291 Q294 P300 K301 G302 E303 A304 R305 T306 K307 R308 A309 V311 Q312 K314 R318 N319 K320 Q321 R325 G339 E340 V341 K342 E345 G346 K347 P348 F355 L359
BS02	rna	LC	A52 S54 I106 K197 M198	A49 S51 I103 K194 M195

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9y, PDBe:8i9y, PDBj:8i9y
PDBsum	8i9y
PubMed	37129998
UniProt	G0SFC3

[Back to BioLiP]