Structure of PDB 7cpv Chain LC

Receptor sequence

>7cpvLC (length=362) Species: 10090 (Mus musculus) [Search protein sequence]

CARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPY
AVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMF
APTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPL
VVEDKVEGYKKTKEAVQLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRI
QRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIW
TESAFRKLDELYGTWRKAASLKSNYNLPMHKMMNTDLSRILKSPEIQRAL
RAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVK
KLEAAATALATK

3D structure

PDB

7cpv A male germ-cell-specific ribosome controls male fertility.

Chain

Resolution

3.03 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LC	C3 A4 R5 P6 K29 R33 N38 F39 H41 T42 N43 R45 N47 N48 R49 Q50 Y52 V54 S55 A58 H60 Q61 T62 S63 T69 G70 R71 A72 V73 A74 R75 I76 P77 R80 G83 T84 R86 Q89 G90 N94 M95 C96 R97 R100 M101 F102 A103 K106 W108 R109 R110 R114 N116 T118 Q119 K120 R121 Y122 K140 K163 T164 K165 K181 K182 Y184 R188 M189 R190 A191 G192 K193 M196 R197 R199 R204 R205 K219 R222 N223 K234 L235 N236 K239 P242 G243 H245 R268 K274 S275 R291 L293 K294 R303 P305 R306 K307 I309 H310 R311 R312 V313 L314 K316 N317 N321 L322 R323 K327 K333 M335 R336 T339 R342 Q343 N346 R350	C1 A2 R3 P4 K27 R31 N36 F37 H39 T40 N41 R43 N45 N46 R47 Q48 Y50 V52 S53 A56 H58 Q59 T60 S61 T67 G68 R69 A70 V71 A72 R73 I74 P75 R78 G81 T82 R84 Q87 G88 N92 M93 C94 R95 R98 M99 F100 A101 K104 W106 R107 R108 R112 N114 T116 Q117 K118 R119 Y120 K138 K161 T162 K163 K179 K180 Y182 R186 M187 R188 A189 G190 K191 M194 R195 R197 R202 R203 K217 R220 N221 K232 L233 N234 K237 P240 G241 H243 R266 K272 S273 R289 L291 K292 R301 P303 R304 K305 I307 H308 R309 R310 V311 L312 K314 N315 N319 L320 R321 K325 K331 M333 R334 T337 R340 Q341 N344 R348
BS02	rna	LC	P51 A53 S55 T107 K195 M196	P49 A51 S53 T105 K193 M194

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0140236	translation at presynapse
GO:0140242	translation at postsynapse

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005791	rough endoplasmic reticulum
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0098793	presynapse
GO:0098794	postsynapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7cpv, PDBe:7cpv, PDBj:7cpv
PDBsum	7cpv
PubMed	36517592
UniProt	Q9D8E6\|RL4_MOUSE Large ribosomal subunit protein uL4 (Gene Name=Rpl4)

[Back to BioLiP]