Structure of PDB 5t7v Chain LC

Receptor sequence

>5t7vLC (length=214) Species: 1280 (Staphylococcus aureus) [Search protein sequence]

TKGILGRKIGMTQVFGENGELIPVTVVEAKENVVLQKKTVEVDGYNAIQV
GFEDKKAYKKDAKSNKYANKPAEGHAKKADAAPKRFIREFRNVDVDAYEV
GQEVSVDTFVAGDVIDVTGVSKGKGFQGAIKRHGQSRGPMSHGHFHRAPG
SVGMASDASRVFKGQKMPGRMGGNTVTVQNLEVVQVDTENKVILVKGNVP
GPKKGLVEIRTSIK

3D structure

PDB

5t7v Structural Basis for Linezolid Binding Site Rearrangement in theStaphylococcus aureusRibosome.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LC	K9 M12 D44 Y46 K60 D62 K64 K67 Y68 N70 K71 P72 K79 R86 E90 R92 K123 K125 G129 K132 R133 R138 S142 H143 H145 R148 S152 V153 M155 A156 S157 D158 A159 S160 R161 V162 F163 M168 R171 T176 T178 Q180 N181 N199 V200 P201 K215	K8 M11 D43 Y45 K59 D61 K63 K66 Y67 N69 K70 P71 K78 R85 E89 R91 K122 K124 G128 K131 R132 R137 S141 H142 H144 R147 S151 V152 M154 A155 S156 D157 A158 S159 R160 V161 F162 M167 R170 T175 T177 Q179 N180 N198 V199 P200 K214

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5t7v, PDBe:5t7v, PDBj:5t7v
PDBsum	5t7v
PubMed	28487427
UniProt	W8U3W0

[Back to BioLiP]