Structure of PDB 8y0u Chain LB

Receptor sequence

>8y0uLB (length=386) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

SHRKYEAPRHGHLGFLPRKRAASIRARVKAFPKDDRSKPVALTSFLGYKA
GMTTIVRDLDRPGSKFHKREVVEAVTVVDTPPVVVVGVVGYVETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYSAKYAQDGAGIERELARI
KKYASVVRVLVHTQIRKTPLAQKKAHLAEIQLNGGSISEKVDWAREHFEK
TVAVDSVFEQNEMIDAIAVTKGHGFEGVTHRWGTKKLPRKTHRGLRKVAC
IGAWHPAHVMWSVARAGQRGYHSRTSINHKIYRVGKGDDEANGATSFDRT
KKTITPMGGFVHYGEIKNDFIMVKGCIPGNRKRIVTLRKSLYTNTSRKAL
EEVSLKWIDTASKFGKGRFQTPAEKHAFMGTLKKDL

3D structure

PDB

8y0u dormant ribosome with STM1

Chain

Resolution

3.59 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	S2 H3 R4 K5 E7 A8 R10 H11 G12 H13 G15 P18 R19 K20 R21 I25 R28 K30 A31 K50 M53 T55 R62 S65 A75 Y92 T95 P96 R97 L99 R100 S101 T104 R116 Y119 K120 N121 Y123 S125 K126 K128 K132 Y154 Q173 K174 K175 L178 E180 T221 K222 H224 G225 F226 G228 R232 K236 K237 R240 K241 H243 R244 G245 L246 R247 K248 V249 A250 C251 I252 A254 W255 H256 A258 H259 V260 S263 R266 A267 Q269 S274 R275 T276 I278 N279 G309 H313 E316 K325 C327 G330 K333 R334 Y343 R348 S363 K364 F365 G366 K367 K376 M380 L383 K384 K385	S1 H2 R3 K4 E6 A7 R9 H10 G11 H12 G14 P17 R18 K19 R20 I24 R27 K29 A30 K49 M52 T54 R61 S64 A74 Y91 T94 P95 R96 L98 R99 S100 T103 R115 Y118 K119 N120 Y122 S124 K125 K127 K131 Y153 Q172 K173 K174 L177 E179 T220 K221 H223 G224 F225 G227 R231 K235 K236 R239 K240 H242 R243 G244 L245 R246 K247 V248 A249 C250 I251 A253 W254 H255 A257 H258 V259 S262 R265 A266 Q268 S273 R274 T275 I277 N278 G308 H312 E315 K324 C326 G329 K332 R333 Y342 R347 S362 K363 F364 G365 K366 K375 M379 L382 K383 K384

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006364	rRNA processing
GO:0006412	translation
GO:0006414	translational elongation
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8y0u, PDBe:8y0u, PDBj:8y0u
PDBsum	8y0u
PubMed	38698775
UniProt	P14126\|RL3_YEAST Large ribosomal subunit protein uL3 (Gene Name=RPL3)

[Back to BioLiP]