Structure of PDB 8pvl Chain LB

Receptor sequence

>8pvlLB (length=389) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

SHRKYEAPRHGSLAFLPRKRAARHRGRVKSFPKDDPKKPVHLTAAMGYKA
GMTTIVRDLDRPGAKAHKKEVVEAVTIIDCPPMVVVGLVGYIETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKYAENNGASITRELER
IKKYCTVVRVLAHTQIRKTPLKQKKAHLMEIQINGGSVADKVEFGRSLFE
KPVTIDTIFEKDEMIDVIAVTKGHGFVGVTARWGTKKLPRKTHKGLRKVA
CIGAWHPSHVQWTVARAGQMGYHHRTSVNHKIYRIGKGDDEANASTETDL
TKKKITPMGGFVRYGEVNNDYVMIKGSVPGVKKRIMTLRKSLFTHTSRKA
LEKVELKWIDTSSEFGHGAFQTAAEKKQFMGTLKKDLQT

3D structure

PDB

8pvl Structural insights into coordinating 5S RNP rotation with ITS2 pre-RNA processing during ribosome formation.

Chain

Resolution

2.19 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	S2 H3 R4 K5 Y6 E7 A8 P9 R10 H11 G12 S13 L14 A15 F16 L17 P18 R19 K20 R21 A23 H25 R26 R28 K30 S31 K50 M53 T54 T55 R62 P63 G64 A65 A75 Y92 I93 T95 R97 L99 R100 S101 L102 T103 T104 R116 R117 F118 Y119 K120 N121 Y123 K124 S125 K126 K128 A129 F130 K132 Y133 R151 Y155 R160 R168 Q174 K175 K176 E181 T222 K223 G224 H225 G226 F227 G229 R233 K237 K238 L239 R241 K242 G246 L247 R248 K249 A251 C252 I253 G254 W256 H257 P258 S259 H260 V261 W263 T264 R267 A268 Q270 Y273 H275 R276 T277 V279 N280 M309 G310 R314 G316 G327 V329 P330 K334 R335 L343 F344 R349 S364 E365 F366 G367 H368 K377 M381 L384 K385	S1 H2 R3 K4 Y5 E6 A7 P8 R9 H10 G11 S12 L13 A14 F15 L16 P17 R18 K19 R20 A22 H24 R25 R27 K29 S30 K49 M52 T53 T54 R61 P62 G63 A64 A74 Y91 I92 T94 R96 L98 R99 S100 L101 T102 T103 R115 R116 F117 Y118 K119 N120 Y122 K123 S124 K125 K127 A128 F129 K131 Y132 R150 Y154 R159 R167 Q173 K174 K175 E180 T221 K222 G223 H224 G225 F226 G228 R232 K236 K237 L238 R240 K241 G245 L246 R247 K248 A250 C251 I252 G253 W255 H256 P257 S258 H259 V260 W262 T263 R266 A267 Q269 Y272 H274 R275 T276 V278 N279 M308 G309 R313 G315 G326 V328 P329 K333 R334 L342 F343 R348 S363 E364 F365 G366 H367 K376 M380 L383 K384

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8pvl, PDBe:8pvl, PDBj:8pvl
PDBsum	8pvl
PubMed	37921038
UniProt	G0RXW1

[Back to BioLiP]