Structure of PDB 8oo0 Chain LB

Receptor sequence

>8oo0LB (length=387) Species: 209285 (Thermochaetoides thermophila)

SHRKYEAPRHGSLAFLPRKRAARHRGRVKSFPKDDPKKPVHLTAAMGYKA
GMTTIVRDLDRPGAKAHKKEVVEAVTIIDCPPMVVVGLVGYIETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKYAENNGASITRELER
IKKYCTVVRVLAHTQIRKTPLKQKKAHLMEIQINGGSVADKVEFGRSLFE
KPVTIDTIFEKDEMIDVIAVTKGHGFVGVTARWGTKKLPRKTHKGLRKVA
CIGAWHPSHVQWTVARAGQMGYHHRTSVNHKIYRIGKGDDEANASTETDL
TKKKITPMGGFVRYGEVNNDYVMIKGSVPGVKKRIMTLRKSLFTHTSRKA
LEKVELKWIDTSSEFGHGAFQTAAEKKQFMGTLKKDL

3D structure

• PDB: 8oo0 Methionine aminopeptidase 2 and its autoproteolysis product have different binding sites on the ribosome.
• Chain: LB
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	S2 H3 K5 E7 R10 H11 G12 R19 K20 R21 K30 S31 M53 T55 A75 Y92 T95 P96 L99 R100 S101 T104 R116 Y119 K120 N121 Y123 K124 K128 A129 K132 Y133 R151 Y155 R160 R168 Q174 E181 K223 G224 H225 F227 G229 K237 R241 H244 K245 G246 R248 K249 A251 C252 I253 W256 H257 S259 H260 V261 T264 R267 Q270 H275 R276 M309 R314 Y315 S328 V329 R335 F366 H368 M381 K385	S1 H2 K4 E6 R9 H10 G11 R18 K19 R20 K29 S30 M52 T54 A74 Y91 T94 P95 L98 R99 S100 T103 R115 Y118 K119 N120 Y122 K123 K127 A128 K131 Y132 R150 Y154 R159 R167 Q173 E180 K222 G223 H224 F226 G228 K236 R240 H243 K244 G245 R247 K248 A250 C251 I252 W255 H256 S258 H259 V260 T263 R266 Q269 H274 R275 M308 R313 Y314 S327 V328 R334 F365 H367 M380 K384

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8oo0, PDBe:8oo0, PDBj:8oo0
• PDBsum: 8oo0
• PubMed: 38267453
• UniProt: G0RXW1