Structure of PDB 8k2b Chain LB

Receptor sequence

>8k2bLB (length=237) Species: 9606 (Homo sapiens)

ANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFL
RFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAG
DTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAA
GTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKA
GRNRWLGKRPNSGRWHRKGGWAGRKIRPLPPMKSYVK

3D structure

• PDB: 8k2b Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: LB
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	A61 W66 K67 I74 T75 K81 S82 G84 R85 H87 G89 R90 I91 R92 V93 G97 G98 H100 K101 Q102 R103 Y104 R105 Q128 Y131 R135 L141 R202 Q205 Y206 I207 R208 A209 A210 G211 P229 S230 R232 R246 V250 H252 N253 I257 G258 K259 A260 G261 R262 N263 R264 W265 K268 R269 P270 N271 S272 G273 R274 W275 H276 K278 G279 G280 A282 G283 R284 I286 R287 K293 Y295	A1 W6 K7 I14 T15 K21 S22 G24 R25 H27 G29 R30 I31 R32 V33 G37 G38 H40 K41 Q42 R43 Y44 R45 Q68 Y71 R75 L81 R142 Q145 Y146 I147 R148 A149 A150 G151 P169 S170 R172 R186 V190 H192 N193 I197 G198 K199 A200 G201 R202 N203 R204 W205 K208 R209 P210 N211 S212 G213 R214 W215 H216 K218 G219 G220 A222 G223 R224 I226 R227 K233 Y235

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k2b, PDBe:8k2b, PDBj:8k2b
• PDBsum: 8k2b
• PubMed: 38942792
• UniProt: Q5T653|RM02_HUMAN Large ribosomal subunit protein uL2m (Gene Name=MRPL2)