Structure of PDB 8k2a Chain LB

Receptor sequence

>8k2aLB (length=237) Species: 9606 (Homo sapiens)

ANFVSWKSRTKYTITPVKMRKSGGRDHTGRIRVHGIGGGHKQRYRMIDFL
RFRPEETKSGPFEEKVIQVRYDPCRSADIALVAGGSRKRWIIATENMQAG
DTILNSNHIGRMAVAAREGDAHPLGALPVGTLINNVESEPGRGAQYIRAA
GTCGVLLRKVNGTAIIQLPSKRQMQVLETCVATVGRVSNVDHNKRVIGKA
GRNRWLGKRPNSGRWHRKGGWAGRKIRPLPPMKSYVK

3D structure

• PDB: 8k2a Structural basis for differential inhibition of eukaryotic ribosomes by tigecycline.
• Chain: LB
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	A61 W66 K67 R69 K71 I74 T75 K78 R80 K81 S82 G83 R85 D86 H87 T88 G89 R90 I91 R92 V93 G98 H100 K101 Q102 R103 Y104 R105 Q128 Y131 P133 R135 L141 R202 Q205 Y206 I207 R208 A209 A210 G211 L228 P229 S230 H252 N253 I257 G258 K259 A260 G261 R262 N263 R264 W265 R269 P270 N271 G273 R274 W275 H276 R277 K278 G279 G280 W281 A282 G283 R284 K285 R287 Y295	A1 W6 K7 R9 K11 I14 T15 K18 R20 K21 S22 G23 R25 D26 H27 T28 G29 R30 I31 R32 V33 G38 H40 K41 Q42 R43 Y44 R45 Q68 Y71 P73 R75 L81 R142 Q145 Y146 I147 R148 A149 A150 G151 L168 P169 S170 H192 N193 I197 G198 K199 A200 G201 R202 N203 R204 W205 R209 P210 N211 G213 R214 W215 H216 R217 K218 G219 G220 W221 A222 G223 R224 K225 R227 Y235
BS02	MG	LB	Y131 D132	Y71 D72

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005762 mitochondrial large ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8k2a, PDBe:8k2a, PDBj:8k2a
• PDBsum: 8k2a
• PubMed: 38942792
• UniProt: Q5T653|RM02_HUMAN Large ribosomal subunit protein uL2m (Gene Name=MRPL2)