Structure of PDB 8i9y Chain LB

Receptor sequence

>8i9yLB (length=356) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

GSLAFLPRKRAARHRGRVKSFPKDDPKKPVHLTAAMGYKAGMTTIVRDLD
RPGAKAHKKEVVEAVTIIDCPPMVVVGLVGYIETPRGLRSLTTVWAEHLS
DEVKRRFYKNWYKSKKKAFTKYAKKYAENNGASITRELERIKKYCTVVRV
LAHTQIRKTPLKQKKAHLMEIQINGGSVADKVEFGRSLFEKPVTIDTIFE
KDEMIDVIAVTKGHGFVGVTARWGTKQWTVARAGQMGYHHRTSVNHKIYR
IGKGDDEANASTETDLTKKKITPMGGFVRYGEVNNDYVMIKGSVPGVKKR
IMTLRKSLFTHTSRKALEKVELKWIDTSSEFGHGAFQTAAEKKQFMGTLK
KDLQTS

3D structure

PDB

8i9y Mechanism of 5S RNP recruitment and helicase-surveilled rRNA maturation during pre-60S biogenesis.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	S13 L14 A15 F16 P18 R19 K20 R21 H25 R26 R28 K30 S31 M53 T54 T55 R62 P63 G64 A65 Y92 T95 P96 R97 L99 R100 S101 L102 T104 R116 R117 F118 Y119 K120 N121 Y123 K124 S125 K126 K128 F130 K132 Y133 R151 Y155 R160 R168 K173 Q174 K175 K176 E181 T222 K223 G224 H225 G226 F227 W263 T264 R267 Q270 Y273 H275 R276 T277 V279 N280 H281 M309 G310 R314 G316 E317 K326 G327 S328 V329 P330 V332 K334 R335 L343 F344 R349 S364 F366 G367 H368 K377 M381 L384 K385	S2 L3 A4 F5 P7 R8 K9 R10 H14 R15 R17 K19 S20 M42 T43 T44 R51 P52 G53 A54 Y81 T84 P85 R86 L88 R89 S90 L91 T93 R105 R106 F107 Y108 K109 N110 Y112 K113 S114 K115 K117 F119 K121 Y122 R140 Y144 R149 R157 K162 Q163 K164 K165 E170 T211 K212 G213 H214 G215 F216 W228 T229 R232 Q235 Y238 H240 R241 T242 V244 N245 H246 M274 G275 R279 G281 E282 K291 G292 S293 V294 P295 V297 K299 R300 L308 F309 R314 S329 F331 G332 H333 K342 M346 L349 K350

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i9y, PDBe:8i9y, PDBj:8i9y
PDBsum	8i9y
PubMed	37129998
UniProt	G0RXW1

[Back to BioLiP]