Structure of PDB 8fkr Chain LB

Receptor sequence

>8fkrLB (length=151) Species: 9606 (Homo sapiens)

GVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKRL
FMSRTNRPPLSLSRMIRKMKLPGRENKTAVVVGTITDDVRVQEVPKLKVC
ALRVTSRARSRILRAGGKILTFDQLALDSPKGCGTVLLSGPRKGREVYRH
F

3D structure

• PDB: 8fkr Principles of human pre-60 S biogenesis.
• Chain: LB
• Resolution: 2.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	G2 R6 H7 N8 R11 K12 V13 R14 R15 S20 K30 F34 R37 R38 T42 F43 M53 S54 R55 T56 R65 R68 L72 P73 R75 K78 T85 T87 D88 D89 R91 R104 T106 S107 C134 G135 T136 L138 S140 R143 K144 G145 R146 E147 R150 F152	G1 R5 H6 N7 R10 K11 V12 R13 R14 S19 K29 F33 R36 R37 T41 F42 M52 S53 R54 T55 R64 R67 L71 P72 R74 K77 T84 T86 D87 D88 R90 R103 T105 S106 C133 G134 T135 L137 S139 R142 K143 G144 R145 E146 R149 F151

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005783 endoplasmic reticulum
• GO:0005791 rough endoplasmic reticulum
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0005925 focal adhesion
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fkr, PDBe:8fkr, PDBj:8fkr
• PDBsum: 8fkr
• PubMed: 37410842
• UniProt: Q07020|RL18_HUMAN Large ribosomal subunit protein eL18 (Gene Name=RPL18)