Structure of PDB 8btr Chain LB

Receptor sequence

>8btrLB (length=378) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

SHRKFSCCRKGNLGYLPRKRCTRGRGRCKTFPPDVQGAPIHLTAFLGYKA
GCTHVMRFIDHRGSNLHNRQAIDQATIIDAPPMICTAIIGYAKTPKGLRA
VTTVWAAHIAEPAMRRFYRNYFHAEKTAFSTYMKKAADGTYIKEQLGRLK
QHADVIRIVAHTQPALTPLKQKKADIMEIQVNGGANVAEKVDYAYALMEK
PISIKDVFSVGAQIDTISITRGRGFEGVVTRWGVTRLPRKTRRGNRKVAC
IGAWHPANVQYTVARAGQMGYFHRTDTNKQVFMIDTAENPRCCTTEFDLT
DKSINPVGGFVNYGRVQGDFIMIKGTCPGPKRRPVVMRNALLPHRNCPPV
QLQWISTASKFGHGIFETVEERRQFYAK

3D structure

PDB

8btr Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

3.25 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	S2 H3 R4 K5 F6 S7 C9 R10 K11 G12 N13 L14 G15 Y16 L17 P18 R19 K20 R21 T23 R24 R26 R28 K30 T31 K50 C53 T54 H55 H62 G64 S65 Q75 Y92 K97 L99 R100 T103 T104 W106 R117 R120 F123 H124 T128 A129 F130 S131 T132 R158 K171 Q172 K173 K174 I177 E179 T221 R222 G223 R224 G225 F226 E227 G228 R232 T236 R237 L238 R240 K241 T242 R243 R244 G245 R247 K248 A250 C251 I252 G253 A254 W255 H256 A258 N259 V260 Y262 T263 R266 A267 Q269 H274 R275 T276 D277 T278 N279 K280 V308 G309 V312 N313 Y314 G315 G326 T327 C328 G330 R333 R334 L343 H345 R346 N347 S360 K361 F362 G363 H364 R373 F376 Y377	S1 H2 R3 K4 F5 S6 C8 R9 K10 G11 N12 L13 G14 Y15 L16 P17 R18 K19 R20 T22 R23 R25 R27 K29 T30 K49 C52 T53 H54 H61 G63 S64 Q74 Y91 K96 L98 R99 T102 T103 W105 R116 R119 F122 H123 T127 A128 F129 S130 T131 R157 K170 Q171 K172 K173 I176 E178 T220 R221 G222 R223 G224 F225 E226 G227 R231 T235 R236 L237 R239 K240 T241 R242 R243 G244 R246 K247 A249 C250 I251 G252 A253 W254 H255 A257 N258 V259 Y261 T262 R265 A266 Q268 H273 R274 T275 D276 T277 N278 K279 V307 G308 V311 N312 Y313 G314 G325 T326 C327 G329 R332 R333 L342 H344 R345 N346 S359 K360 F361 G362 H363 R372 F375 Y376

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8btr, PDBe:8btr, PDBj:8btr
PDBsum	8btr
PubMed	36912103
UniProt	A8BRZ3

[Back to BioLiP]