Structure of PDB 8bsj Chain LB

Receptor sequence

>8bsjLB (length=374) Species: 5741 (Giardia intestinalis) [Search protein sequence]

SHRKFSCCRKGNLGYLPRKRCTRGRGRCKTFPPDVQGAPIHLTAFLGYKA
GCTHVMRFIDHRLHNRQAIDQATIIDAPPMICTAIIGYAKTPKGLRAVTT
VWAAHIAEPAMRRFYRNYFHAEKTAFSTYMKKAADGTYIKEQLGRLKQHA
DVIRIVAHTQPALTPLKQKKADIMEIQVNGGANVAEKVDYAYALMEKPIS
IKDVFSVGAQIDTISITRGRGFEGVVTRWGVTRLPRKTRRGNRKVACIGA
WHPANVQYTVARAGQMGYFHRTDTNKQVFMIDTAENPRCCTTEFDLTDKS
INPVGGFVNYGRVQGDFIMIKGTCPGPKRRPVVMRNALLPHRNCPPVQLQ
WISTASKFGHGIFETVEERRQFYA

3D structure

PDB

8bsj Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

6.49 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	S2 H3 R4 S7 C9 K11 G12 N13 L14 G15 Y16 L17 P18 R19 K20 R21 T23 R24 R26 R28 K30 T31 C53 H62 R63 Q75 Y92 K97 G98 L99 R100 T103 T104 R117 F118 R120 F123 H124 A129 F130 S131 T132 K136 R158 L170 K171 Q172 K173 K174 E179 T221 R222 G223 R224 G225 F226 G228 T231 R232 T236 R237 R240 K241 T242 R243 R244 G245 R247 K248 A250 C251 I252 G253 A254 W255 H256 A258 N259 V260 Q261 Y262 T263 R266 A267 Q269 Y272 H274 R275 T276 D277 T278 N279 K280 G309 V312 N313 Y314 G315 K325 G326 T327 C328 P329 G330 K332 R333 R334 R339 L343 H345 R346 N347 K361 F362 G363 H364 R373 R374 F376 Y377	S1 H2 R3 S6 C8 K10 G11 N12 L13 G14 Y15 L16 P17 R18 K19 R20 T22 R23 R25 R27 K29 T30 C52 H61 R62 Q71 Y88 K93 G94 L95 R96 T99 T100 R113 F114 R116 F119 H120 A125 F126 S127 T128 K132 R154 L166 K167 Q168 K169 K170 E175 T217 R218 G219 R220 G221 F222 G224 T227 R228 T232 R233 R236 K237 T238 R239 R240 G241 R243 K244 A246 C247 I248 G249 A250 W251 H252 A254 N255 V256 Q257 Y258 T259 R262 A263 Q265 Y268 H270 R271 T272 D273 T274 N275 K276 G305 V308 N309 Y310 G311 K321 G322 T323 C324 P325 G326 K328 R329 R330 R335 L339 H341 R342 N343 K357 F358 G359 H360 R369 R370 F372 Y373

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8bsj, PDBe:8bsj, PDBj:8bsj
PDBsum	8bsj
PubMed	36912103
UniProt	A8BRZ3

[Back to BioLiP]