Structure of PDB 7z3o Chain LB

Receptor sequence

>7z3oLB (length=387) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

SHRKYEAPRHGSLAFLPRKRAARHRGRVKSFPKDDPKKPVHLTAAMGYKA
GMTTIVRDLDRPGAKAHKKEVVEAVTIIDCPPMVVVGLVGYIETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKYAENNGASITRELER
IKKYCTVVRVLAHTQIRKTPLKQKKAHLMEIQINGGSVADKVEFGRSLFE
KPVTIDTIFEKDEMIDVIAVTKGHGFVGVTARWGTKKLPRKTHKGLRKVA
CIGAWHPSHVQWTVARAGQMGYHHRTSVNHKIYRIGKGDDEANASTETDL
TKKKITPMGGFVRYGEVNNDYVMIKGSVPGVKKRIMTLRKSLFTHTSRKA
LEKVELKWIDTSSEFGHGAFQTAAEKKQFMGTLKKDL

3D structure

PDB

7z3o Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	S2 H3 K5 E7 A8 R10 H11 G12 S13 F16 P18 R19 K20 R21 K30 S31 M53 T55 A75 Y92 T95 P96 R97 L99 R100 S101 L102 T104 R116 R117 F118 K120 N121 Y123 K124 K128 A129 K132 Y133 R151 Y155 Q174 K175 E181 T222 K223 G224 H225 G226 F227 G229 R233 K237 R241 K242 H244 K245 G246 R248 K249 A251 C252 I253 W256 H257 S259 H260 V261 T264 R267 A268 Q270 H275 V279 N280 G310 R314 Y315 E317 S328 V329 P330 R335 S364 F366 H368 K377 M381 K385	S1 H2 K4 E6 A7 R9 H10 G11 S12 F15 P17 R18 K19 R20 K29 S30 M52 T54 A74 Y91 T94 P95 R96 L98 R99 S100 L101 T103 R115 R116 F117 K119 N120 Y122 K123 K127 A128 K131 Y132 R150 Y154 Q173 K174 E180 T221 K222 G223 H224 G225 F226 G228 R232 K236 R240 K241 H243 K244 G245 R247 K248 A250 C251 I252 W255 H256 S258 H259 V260 T263 R266 A267 Q269 H274 V278 N279 G309 R313 Y314 E316 S327 V328 P329 R334 S363 F365 H367 K376 M380 K384
BS02	MG	LB	S2 H3	S1 H2

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7z3o, PDBe:7z3o, PDBj:7z3o
PDBsum	7z3o
PubMed	37081320
UniProt	G0RXW1

[Back to BioLiP]