Structure of PDB 7z3n Chain LB

Receptor sequence

>7z3nLB (length=387) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

SHRKYEAPRHGSLAFLPRKRAARHRGRVKSFPKDDPKKPVHLTAAMGYKA
GMTTIVRDLDRPGAKAHKKEVVEAVTIIDCPPMVVVGLVGYIETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKYAENNGASITRELER
IKKYCTVVRVLAHTQIRKTPLKQKKAHLMEIQINGGSVADKVEFGRSLFE
KPVTIDTIFEKDEMIDVIAVTKGHGFVGVTARWGTKKLPRKTHKGLRKVA
CIGAWHPSHVQWTVARAGQMGYHHRTSVNHKIYRIGKGDDEANASTETDL
TKKKITPMGGFVRYGEVNNDYVMIKGSVPGVKKRIMTLRKSLFTHTSRKA
LEKVELKWIDTSSEFGHGAFQTAAEKKQFMGTLKKDL

3D structure

PDB

7z3n Structural inventory of cotranslational protein folding by the eukaryotic RAC complex.

Chain

Resolution

3.2 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	S2 H3 K5 E7 A8 P9 R10 H11 G12 S13 A15 P18 K20 R21 H25 K30 S31 M53 T55 A75 Y92 P96 R97 L99 R100 S101 L102 T104 R116 R117 K120 Y123 K124 K128 A129 K132 Y133 R151 Y155 R168 Q174 K175 K176 E181 T222 K223 G224 H225 G226 F227 G229 K237 K238 R241 K242 T243 H244 K245 G246 R248 K249 A251 C252 A255 W256 H257 S259 H260 V261 T264 R267 A268 H275 R276 N280 G310 R314 Y315 S328 P330 V332 R335 S364 E365 F366 H368 K377 M381 L384 K385 K386	S1 H2 K4 E6 A7 P8 R9 H10 G11 S12 A14 P17 K19 R20 H24 K29 S30 M52 T54 A74 Y91 P95 R96 L98 R99 S100 L101 T103 R115 R116 K119 Y122 K123 K127 A128 K131 Y132 R150 Y154 R167 Q173 K174 K175 E180 T221 K222 G223 H224 G225 F226 G228 K236 K237 R240 K241 T242 H243 K244 G245 R247 K248 A250 C251 A254 W255 H256 S258 H259 V260 T263 R266 A267 H274 R275 N279 G309 R313 Y314 S327 P329 V331 R334 S363 E364 F365 H367 K376 M380 L383 K384 K385
BS02	MG	LB	S2 H3	S1 H2

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7z3n, PDBe:7z3n, PDBj:7z3n
PDBsum	7z3n
PubMed	37081320
UniProt	G0RXW1

[Back to BioLiP]