Structure of PDB 7old Chain LB

Receptor sequence

>7oldLB (length=387) Species: 759272 (Thermochaetoides thermophila DSM 1495) [Search protein sequence]

SHRKYEAPRHGSLAFLPRKRAARHRGRVKSFPKDDPKKPVHLTAAMGYKA
GMTTIVRDLDRPGAKAHKKEVVEAVTIIDCPPMVVVGLVGYIETPRGLRS
LTTVWAEHLSDEVKRRFYKNWYKSKKKAFTKYAKKYAENNGASITRELER
IKKYCTVVRVLAHTQIRKTPLKQKKAHLMEIQINGGSVADKVEFGRSLFE
KPVTIDTIFEKDEMIDVIAVTKGHGFVGVTARWGTKKLPRKTHKGLRKVA
CIGAWHPSHVQWTVARAGQMGYHHRTSVNHKIYRIGKGDDEANASTETDL
TKKKITPMGGFVRYGEVNNDYVMIKGSVPGVKKRIMTLRKSLFTHTSRKA
LEKVELKWIDTSSEFGHGAFQTAAEKKQFMGTLKKDL

3D structure

PDB

7old High-resolution structures of a thermophilic eukaryotic 80S ribosome reveal atomistic details of translocation.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	S2 H3 E7 A8 R10 H11 S13 A15 F16 P18 R19 K20 R21 H25 K30 S31 M53 T55 A75 Y92 P96 L99 R100 S101 L102 T104 R116 R117 Y119 K120 N121 Y123 K124 K128 A129 K132 Y133 R151 Y155 R160 Q174 K175 K176 E181 K223 G224 H225 G226 F227 G229 R233 R241 K242 H244 K245 L247 R248 K249 A251 C252 I253 W256 H257 S259 H260 V261 T264 R267 A268 H275 R276 T277 M309 G310 R314 Y315 S328 V329 R335 R349 S364 E365 F366 H368 M381 K385 K386	S1 H2 E6 A7 R9 H10 S12 A14 F15 P17 R18 K19 R20 H24 K29 S30 M52 T54 A74 Y91 P95 L98 R99 S100 L101 T103 R115 R116 Y118 K119 N120 Y122 K123 K127 A128 K131 Y132 R150 Y154 R159 Q173 K174 K175 E180 K222 G223 H224 G225 F226 G228 R232 R240 K241 H243 K244 L246 R247 K248 A250 C251 I252 W255 H256 S258 H259 V260 T263 R266 A267 H274 R275 T276 M308 G309 R313 Y314 S327 V328 R334 R348 S363 E364 F365 H367 M380 K384 K385

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7old, PDBe:7old, PDBj:7old
PDBsum	7old
PubMed	35079002
UniProt	G0RXW1

[Back to BioLiP]