Structure of PDB 6b4v Chain LB

Receptor sequence

>6b4vLB (length=181) Species: 262724 (Thermus thermophilus HB27)

PLDLALKRKYYEEVRPELIRRFGYQNVWEVPRLEKVVINQGLGEAKEDAR
ILEKAAQELALITGQKPAVTRAKKSISNFKLRKGMPIGLRVTLRRDRMWI
FLEKLLNVALPRIRDFRGLNPNSFDGRGNYNLGLREQLIFPEITYDMVDA
LRGMDIAVVTTAETDEEARALLELLGFPFRK

3D structure

• PDB: 6b4v Mechanism of Inhibition of Translation Termination by Blasticidin S.
• Chain: LB
• Resolution: 3.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LB	K36 V38 N40 G42 L43 G44 K47 T71 A73 K74 K75 F80 I88 S124 D126 R128 N132 L133 L135 R136 G154 D156	K35 V37 N39 G41 L42 G43 K46 T70 A72 K73 K74 F79 I87 S123 D125 R127 N131 L132 L134 R135 G153 D155
BS02	rna	LB	P2 N27 W29 E30 Q66 K67 A69 V70 T71 R91 V92 T93 R95 R96 R98	P1 N26 W28 E29 Q65 K66 A68 V69 T70 R90 V91 T92 R94 R95 R97
BS03	rna	LB	S76 I77 S78 R83	S75 I76 S77 R82

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6b4v, PDBe:6b4v, PDBj:6b4v
• PDBsum: 6b4v
• PubMed: 29366636
• UniProt: Q72I16|RL5_THET2 Large ribosomal subunit protein uL5 (Gene Name=rplE)