Structure of PDB 8fkv Chain LA

Receptor sequence

>8fkvLA (length=160) Species: 9606 (Homo sapiens)

VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLQKQCVPFRRYNGGVGRCAQAKQWGWTQGRWPKKSAEFLLHMLKNAESN
AELKGLDVDSLVIEHIQVNKAPKMSSPCHIEMILTEKEQIVPKPEEEVAQ
KKKISQKKLK

3D structure

• PDB: 8fkv Principles of human pre-60 S biogenesis.
• Chain: LA
• Resolution: 2.47 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LA	R3 S5 R61 R62 W78 N120 P123	R2 S4 R60 R61 W77 N119 P122
BS02	rna	LA	R3 Y4 R18 S20 H25 K27 R30 Q34 K37 K43 Q54 R62 Y63 G65 G66 R69 A71 K74 Q75 T79 Q80 R82 W83 K85 K86 H93 N97 S100 N101 Q118 V119 M140 S141 E162 K173	R2 Y3 R17 S19 H24 K26 R29 Q33 K36 K42 Q53 R61 Y62 G64 G65 R68 A70 K73 Q74 T78 Q79 R81 W82 K84 K85 H92 N96 S99 N100 Q117 V118 M124 S125 E146 K157

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fkv, PDBe:8fkv, PDBj:8fkv
• PDBsum: 8fkv
• PubMed: 37410842
• UniProt: P18621|RL17_HUMAN Large ribosomal subunit protein uL22 (Gene Name=RPL17)