Structure of PDB 8fks Chain LA

Receptor sequence
>8fksLA (length=121) Species: 9606 (Homo sapiens) [Search protein sequence]
VRYSLDPENPTKSCKSRGSNLRVHFKNTRETAQAIKGMHIRKATKYLKDV
TLQKQCVPFRRYNRWPKKSAEFLLHMLKNAESNAELKGLDVDSLVIEHIQ
VNKAPKMSSPCHIEMILTEKE
3D structure
PDB8fks Principles of human pre-60 S biogenesis.
ChainLA
Resolution2.88 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna LA R3 S5 R61 R62 N120 P123 R2 S4 R60 R61 N102 P105
BS02 rna LA Y4 L6 K16 R18 S20 H25 F26 K27 R30 K37 R62 Y63 N64 R82 W83 K85 K86 H93 N97 S100 N101 Q118 V119 S141 Y3 L5 K15 R17 S19 H24 F25 K26 R29 K36 R61 Y62 N63 R64 W65 K67 K68 H75 N79 S82 N83 Q100 V101 S108
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8fks, PDBe:8fks, PDBj:8fks
PDBsum8fks
PubMed37410842
UniProtP18621|RL17_HUMAN Large ribosomal subunit protein uL22 (Gene Name=RPL17)

[Back to BioLiP]