Structure of PDB 8btd Chain LA

Receptor sequence

>8btdLA (length=250) Species: 184922 (Giardia lamblia ATCC 50803) [Search protein sequence]

GRRIRVQRKGAGSVFRAHVARRLGAAKLRANDFAERTGSVRGVVKAILHD
RGRGAPLARVQFPNMRGEGRVNELFIAPEGMYTGQEVFSGNKATLHIGNI
LPVGNIPEGTYVCNVEEKPMDRGCLARASGTYCLVVAHNMETNKTRIRLP
SGQKKLISSKARAMIGLVAGGGRTDKPLLKAGNAYHKYKAKRNCWPVVRG
VAMNPVDHPHGGGNHQHIGVSSCVPRNAVPGQKVGLIAARRTGCSGGKRR

3D structure

PDB

8btd Insights into translocation mechanism and ribosome evolution from cryo-EM structures of translocation intermediates of Giardia intestinalis.

Chain

Resolution

4.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LA	G2 R3 R4 V7 Q8 R9 G11 S14 V15 F16 A18 H19 V20 R22 R23 G25 F34 R37 H50 R52 R54 M66 R67 E69 G70 E118 K119 P120 M121 R123 C125 L126 A127 R128 A129 S130 G131 T132 L150 P151 S152 Q154 K156 G173 R174 T175 K177 L179 L180 K181 A182 G183 H187 K188 K190 R193 N194 W196 P197 V198 V199 R200 G201 V202 M204 N205 P206 V207 D208 H209 H211 G213 G214 N215 H216 Q217 H218 V221 S222 S223 C224 P226 R227 N228 V230 P231 G232 Q233 K234 V235 G236 L237 I238 A239 A240 R241 R242 T243 G244 K249	G1 R2 R3 V6 Q7 R8 G10 S13 V14 F15 A17 H18 V19 R21 R22 G24 F33 R36 H49 R51 R53 M65 R66 E68 G69 E117 K118 P119 M120 R122 C124 L125 A126 R127 A128 S129 G130 T131 L149 P150 S151 Q153 K155 G172 R173 T174 K176 L178 L179 K180 A181 G182 H186 K187 K189 R192 N193 W195 P196 V197 V198 R199 G200 V201 M203 N204 P205 V206 D207 H208 H210 G212 G213 N214 H215 Q216 H217 V220 S221 S222 C223 P225 R226 N227 V229 P230 G231 Q232 K233 V234 G235 L236 I237 A238 A239 R240 R241 T242 G243 K248
BS02	rna	LA	E109 G110 N140 E142 R147 D176 R250 R251	E108 G109 N139 E141 R146 D175 R249 R250

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8btd, PDBe:8btd, PDBj:8btd
PDBsum	8btd
PubMed	36912103
UniProt	E2RTN4

[Back to BioLiP]