Structure of PDB 7n2c Chain LA

Receptor sequence

>7n2cLA (length=134) Species: 83333 (Escherichia coli K-12)

KLTKRMRVIREKVDATKQYDINEAIALLKELATAKFVESVDVAVNLGIDA
RKSDQNVRGATVLPHGTGQVRYRNDKNGIIHTTIGKVDFDADKLKENLEA
LLVALKKAKPTQAKGVYIKKVSISTTMGAGVAVD

3D structure

• PDB: 7n2c Structural basis of early translocation events on the ribosome.
• Chain: LA
• Resolution: 2.72 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	LA	F38 N168 I170 H172 V207 S215 T217	F36 N77 I79 H81 V116 S124 T126
BS02	rna	LA	R53 K54	R51 K52

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Fri Nov 15 21:43:12 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7n2c', asym_id = 'LA', title = 'Structural basis of early translocation events on the ribosome.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7n2c', asym_id='LA', title='Structural basis of early translocation events on the ribosome.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0006412,0015934', uniprot = '', pdbid = '7n2c', asym_id = 'LA'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015934', uniprot='', pdbid='7n2c', asym_id='LA')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>