Structure of PDB 8fkv Chain L9

Receptor sequence

>8fkvL9 (length=183) Species: 9606 (Homo sapiens)

GAYKYIQELWRKKQSDVMRFLLRVRCWQYRQLSALHRAPRPTRPDKARRL
GYKAKQGYVIYRIRVRRGGQLKFARSLQSVAEERAGRHCGALRVLNSYWV
GEDSTYKFFEVILIDPFHKAIRRNPDTQWITKPVHKHREMRGLTSAGRKS
RGLGKGHKFHHTIGGSRRAAWRRRNTLQLHRYR

3D structure

• PDB: 8fkv Principles of human pre-60 S biogenesis.
• Chain: L9
• Resolution: 2.47 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	L9	R38 Q57 Y62 H109 D136 H139	R37 Q56 Y61 H88 D115 H118
BS02	rna	L9	G2 Y4 Q8 R12 K14 Q15 P40 R41 R44 K47 R49 R50 L51 K54 A55 K56 R68 L92 K93 F94 A95 S97 R108 A112 W120 F138 R144 W150 V155 H156 K157 H158 M161 R162 R169 S171 R172 K176 G177 H178 K179 H181 H182 I184 G186 S187 R188 W192 R193 R194 R195 H201 R202 Y203 R204	G1 Y3 Q7 R11 K13 Q14 P39 R40 R43 K46 R48 R49 L50 K53 A54 K55 R67 L71 K72 F73 A74 S76 R87 A91 W99 F117 R123 W129 V134 H135 K136 H137 M140 R141 R148 S150 R151 K155 G156 H157 K158 H160 H161 I163 G165 S166 R167 W171 R172 R173 R174 H180 R181 Y182 R183
BS03	MG	L9	G175 F180 T183	G154 F159 T162

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0045296 cadherin binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0045471 response to ethanol

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:0031672 A band
• GO:0044391 ribosomal subunit
• GO:0045202 synapse
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8fkv, PDBe:8fkv, PDBj:8fkv
• PDBsum: 8fkv
• PubMed: 37410842
• UniProt: P61313|RL15_HUMAN Large ribosomal subunit protein eL15 (Gene Name=RPL15)